PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 505aa    MW: 57228.4 Da    PI: 5.9438
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15864.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.81.4e-46111401128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                 +p+GfrF+Ptdeelv++yLk+k+ ++++++ ++i+e+d++kvePwd p +  +k+++ ew+fFs+ d ky ++kr nr+tk+g+Wkatg+d+++    +
  KHN15864.1  11 MPVGFRFRPTDEELVDYYLKHKLLADDFPV-HIIPEIDLCKVEPWDVPgRsVIKSDDPEWFFFSPVDYKYLKSKRFNRTTKRGFWKATGNDRKIRIPgT 108
                 699***************************.89***************6347778888*************************************9977 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++++g+kktLvf++gr p+g kt+Wv+hey++
  KHN15864.1 109 SNVIGTKKTLVFHQGRVPRGAKTNWVIHEYHA 140
                 888***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-518158IPR003441NAC domain
PROSITE profilePS5100551.89711158IPR003441NAC domain
PfamPF023654.8E-2512139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MENIISICDH MPVGFRFRPT DEELVDYYLK HKLLADDFPV HIIPEIDLCK VEPWDVPGRS  60
VIKSDDPEWF FFSPVDYKYL KSKRFNRTTK RGFWKATGND RKIRIPGTSN VIGTKKTLVF  120
HQGRVPRGAK TNWVIHEYHA VTSHESQRAF VLCRLMKKAE KKNEGGIEAP SFDEGEPSIH  180
MVSDYGNPAR AEGIASVDII PGVDMDEIFR AVDQAEKFSP PVQQSPTGIG LEDFFPNSPL  240
FNARFGSENI NMQTSLEVTD DEDELVNSFL VYDEEFVINE ERRHCFVNSS TQPKSLRRVY  300
NESSEMDAEV VSNLNEHISS GEYPALKMFK SSHDVVRGGP SRLALNQKAN KEKKESIIQD  360
DLWAVETSSC DSTADEPIEI SSSPSTPTRL KNQYHLRPEN LILQRTVAGR PQTQKVSNNA  420
VSHLEVQKEL LTVKSEKDQK NAQNTSSRGN LKNKSQQSSD VNNNGSFFYM EMTSNQSLFP  480
RSVYLVNVVI GILLLIVISW DVLSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-371115817165NO APICAL MERISTEM PROTEIN
1ut4_B6e-371115817165NO APICAL MERISTEM PROTEIN
1ut7_A6e-371115817165NO APICAL MERISTEM PROTEIN
1ut7_B6e-371115817165NO APICAL MERISTEM PROTEIN
3swm_A7e-371115820168NAC domain-containing protein 19
3swm_B7e-371115820168NAC domain-containing protein 19
3swm_C7e-371115820168NAC domain-containing protein 19
3swm_D7e-371115820168NAC domain-containing protein 19
3swp_A7e-371115820168NAC domain-containing protein 19
3swp_B7e-371115820168NAC domain-containing protein 19
3swp_C7e-371115820168NAC domain-containing protein 19
3swp_D7e-371115820168NAC domain-containing protein 19
4dul_A6e-371115817165NAC domain-containing protein 19
4dul_B6e-371115817165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150422e-76AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529865.10.0PREDICTED: NAC domain-containing protein 69-like
TrEMBLA0A0B2Q7D00.0A0A0B2Q7D0_GLYSO; NAC domain-containing protein 69
STRINGGLYMA07G05351.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-55NAC domain containing protein 62
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]